Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (58 species) not a true protein |
Species Influenza virus a/anhui/1/2013 (h7n9) [TaxId:11320] [226707] (6 PDB entries) |
Domain d4bsfa_: 4bsf A: [219544] Other proteins in same PDB: d4bsfb_ automated match to d1rd8a_ complexed with nag, so4 |
PDB Entry: 4bsf (more details), 2.76 Å
SCOPe Domain Sequences for d4bsfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bsfa_ b.19.1.0 (A:) automated matches {Influenza virus a/anhui/1/2013 (h7n9) [TaxId: 11320]} dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv kqrslllatgmknvpei
Timeline for d4bsfa_: