SCOPe 2.04: Domain d4bsea_: 4bse A:

Lineage for d4bsea_ (4bse A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (14 species)
   not a true protein

7. Species Influenza virus a/anhui/1/2013 (h7n9) [TaxId:11320] [226707] (6 PDB entries)

8. Domain d4bsea_: 4bse A: [219543]
   Other proteins in same PDB: d4bseb_
   automated match to d1rd8a_
   complexed with nag, so4

Details for d4bsea_

PDB Entry: 4bse, 2.55 Å

PDB Description: human h7n9 influenza virus haemagglutinin in complex with human receptor analogue lstc

PDB Compounds: (A:) haemagglutinin ha1

SCOPe Domain Sequences for d4bsea_:

Sequence; same for both SEQRES and ATOM records:

>d4bsea_ b.19.1.0 (A:) automated matches {Influenza virus a/anhui/1/2013 (h7n9) [TaxId: 11320]}
dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
kqrslllatgmknvpei

Timeline for d4bsea_:

• d4bsea_ first appeared in SCOPe 2.03
  
• d4bsea_ appears in SCOPe 2.05
  
• d4bsea_ appears in the current release, SCOPe 2.08