Lineage for d4bsea_ (4bse A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1305718Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1305719Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1306141Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 1306142Protein automated matches [227017] (8 species)
    not a true protein
  7. 1306192Species Influenza virus a/anhui/1/2013 (h7n9) [TaxId:11320] [226707] (6 PDB entries)
  8. 1306197Domain d4bsea_: 4bse A: [219543]
    automated match to d1rd8a_
    complexed with nag, so4

Details for d4bsea_

PDB Entry: 4bse (more details), 2.55 Å

PDB Description: human h7n9 influenza virus haemagglutinin in complex with human receptor analogue lstc
PDB Compounds: (A:) haemagglutinin ha1

SCOPe Domain Sequences for d4bsea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bsea_ b.19.1.0 (A:) automated matches {Influenza virus a/anhui/1/2013 (h7n9) [TaxId: 11320]}
dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
kqrslllatgmknvpei

SCOPe Domain Coordinates for d4bsea_:

Click to download the PDB-style file with coordinates for d4bsea_.
(The format of our PDB-style files is described here.)

Timeline for d4bsea_: