Lineage for d4bsda_ (4bsd A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776775Species Influenza virus a/anhui/1/2013 (h7n9) [TaxId:11320] [226707] (6 PDB entries)
  8. 2776778Domain d4bsda_: 4bsd A: [219542]
    Other proteins in same PDB: d4bsdb_
    automated match to d1rd8a_
    complexed with nag, so4

Details for d4bsda_

PDB Entry: 4bsd (more details), 2.4 Å

PDB Description: human h7n9 influenza virus haemagglutinin (with asn-133 glycosylation) in complex with avian receptor analogue 3'-sln
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4bsda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bsda_ b.19.1.0 (A:) automated matches {Influenza virus a/anhui/1/2013 (h7n9) [TaxId: 11320]}
dkiclghhalsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
rtngttsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
kqrslllatgmknvpei

SCOPe Domain Coordinates for d4bsda_:

Click to download the PDB-style file with coordinates for d4bsda_.
(The format of our PDB-style files is described here.)

Timeline for d4bsda_: