SCOPe 2.04: Domain d4bsba_: 4bsb A:

Lineage for d4bsba_ (4bsb A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (14 species)
   not a true protein

7. Species Influenza virus a/anhui/1/2013 (h7n9) [TaxId:11320] [226707] (6 PDB entries)

8. Domain d4bsba_: 4bsb A: [219540]
   Other proteins in same PDB: d4bsbb_
   automated match to d1rd8a_
   complexed with nag, so4

Details for d4bsba_

PDB Entry: 4bsb, 2.35 Å

PDB Description: human h7n9 influenza virus haemagglutinin (with asn-133 glycosylation) in complex with human receptor analogue lstc

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4bsba_:

Sequence; same for both SEQRES and ATOM records:

>d4bsba_ b.19.1.0 (A:) automated matches {Influenza virus a/anhui/1/2013 (h7n9) [TaxId: 11320]}
dkiclghhalsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
rtngttsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
kqrslllatgmknvpei

Timeline for d4bsba_:

• d4bsba_ first appeared in SCOPe 2.03
  
• d4bsba_ appears in SCOPe 2.05
  
• d4bsba_ appears in the current release, SCOPe 2.08