![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (58 species) not a true protein |
![]() | Species Influenza virus a/anhui/1/2013 (h7n9) [TaxId:11320] [226707] (6 PDB entries) |
![]() | Domain d4bsba_: 4bsb A: [219540] Other proteins in same PDB: d4bsbb_ automated match to d1rd8a_ complexed with nag, so4 |
PDB Entry: 4bsb (more details), 2.35 Å
SCOPe Domain Sequences for d4bsba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bsba_ b.19.1.0 (A:) automated matches {Influenza virus a/anhui/1/2013 (h7n9) [TaxId: 11320]} dkiclghhalsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi rtngttsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv kqrslllatgmknvpei
Timeline for d4bsba_: