Lineage for d1danu1 (1dan U:107-210)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 657193Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 657194Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
    Pfam PF00041
  6. 657284Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 657285Species Human (Homo sapiens) [TaxId:9606] [49268] (10 PDB entries)
  8. 657291Domain d1danu1: 1dan U:107-210 [21954]
    Other proteins in same PDB: d1danh_, d1danl1, d1danl2, d1danl3
    complexed with ca, cac, ch2, cl, fuc, glc

Details for d1danu1

PDB Entry: 1dan (more details), 2 Å

PDB Description: Complex of active site inhibited human blood coagulation factor VIIA with human recombinant soluble tissue factor
PDB Compounds: (U:) soluble tissue factor

SCOP Domain Sequences for d1danu1:

Sequence, based on SEQRES records: (download)

>d1danu1 b.1.2.1 (U:107-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecm

Sequence, based on observed residues (ATOM records): (download)

>d1danu1 b.1.2.1 (U:107-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywsgkktakt
ntneflidvdkgenycfsvqavipsrtvnrkstdspvecm

SCOP Domain Coordinates for d1danu1:

Click to download the PDB-style file with coordinates for d1danu1.
(The format of our PDB-style files is described here.)

Timeline for d1danu1: