Lineage for d1danu1 (1dan U:107-210)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 160936Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 160937Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 160982Protein Extracellular region of human tissue factor [49267] (2 species)
  7. 160983Species Human (Homo sapiens) [TaxId:9606] [49268] (7 PDB entries)
  8. 160989Domain d1danu1: 1dan U:107-210 [21954]
    Other proteins in same PDB: d1danh_, d1danl1, d1danl2, d1danl3

Details for d1danu1

PDB Entry: 1dan (more details), 2 Å

PDB Description: complex of active site inhibited human blood coagulation factor viia with human recombinant soluble tissue factor

SCOP Domain Sequences for d1danu1:

Sequence, based on SEQRES records: (download)

>d1danu1 b.1.2.1 (U:107-210) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecm

Sequence, based on observed residues (ATOM records): (download)

>d1danu1 b.1.2.1 (U:107-210) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywsgkktakt
ntneflidvdkgenycfsvqavipsrtvnrkstdspvecm

SCOP Domain Coordinates for d1danu1:

Click to download the PDB-style file with coordinates for d1danu1.
(The format of our PDB-style files is described here.)

Timeline for d1danu1: