Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (12 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [187329] (6 PDB entries) |
Domain d4brxa_: 4brx A: [219538] automated match to d2jkka_ complexed with kgw, so4 |
PDB Entry: 4brx (more details), 2.05 Å
SCOPe Domain Sequences for d4brxa_:
Sequence, based on SEQRES records: (download)
>d4brxa_ d.144.1.7 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} rdyeiqrerielgrcigegqfgdvhqgiymspenpamavaiktcknctsdsvrekflqea ltmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkfsldlaslilyayqlst alayleskrfvhrdiaarnvlvsatdcvklgdfglsrymedstyykaskgklpikwmape sinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptly slmtkcwaydpsrrprftelkaqlstileeek
>d4brxa_ d.144.1.7 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} rdyeiqrerielgrcigegqfgdvhqgiymspenpamavaiktcknctsdsvrekflqea ltmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkfsldlaslilyayqlst alayleskrfvhrdiaarnvlvsatdcvklgdfglsrymlpikwmapesinfrrftsasd vwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydps rrprftelkaqlstileeek
Timeline for d4brxa_: