Lineage for d4brxa_ (4brx A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (20 species)
    not a true protein
  7. 2545148Species Chicken (Gallus gallus) [TaxId:9031] [187329] (17 PDB entries)
  8. 2545159Domain d4brxa_: 4brx A: [219538]
    automated match to d2jkka_
    complexed with kgw, so4

Details for d4brxa_

PDB Entry: 4brx (more details), 2.05 Å

PDB Description: focal adhesion kinase catalytic domain in complex with a diarylamino- 1,3,5-triazine inhibitor
PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d4brxa_:

Sequence, based on SEQRES records: (download)

>d4brxa_ d.144.1.7 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rdyeiqrerielgrcigegqfgdvhqgiymspenpamavaiktcknctsdsvrekflqea
ltmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkfsldlaslilyayqlst
alayleskrfvhrdiaarnvlvsatdcvklgdfglsrymedstyykaskgklpikwmape
sinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptly
slmtkcwaydpsrrprftelkaqlstileeek

Sequence, based on observed residues (ATOM records): (download)

>d4brxa_ d.144.1.7 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rdyeiqrerielgrcigegqfgdvhqgiymspenpamavaiktcknctsdsvrekflqea
ltmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkfsldlaslilyayqlst
alayleskrfvhrdiaarnvlvsatdcvklgdfglsrymlpikwmapesinfrrftsasd
vwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydps
rrprftelkaqlstileeek

SCOPe Domain Coordinates for d4brxa_:

Click to download the PDB-style file with coordinates for d4brxa_.
(The format of our PDB-style files is described here.)

Timeline for d4brxa_: