| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 proteins) similar to the nucleotide/nucleoside kinases but acts on different substrate automatically mapped to Pfam PF01202 |
| Protein Shikimate kinase (AroK) [52567] (4 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [75194] (11 PDB entries) Uniprot P95014 |
| Domain d4bqsb_: 4bqs B: [219536] automated match to d1zyua_ complexed with adp, k2q |
PDB Entry: 4bqs (more details), 2.15 Å
SCOPe Domain Sequences for d4bqsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bqsb_ c.37.1.2 (B:) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}
apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrlqvps
Timeline for d4bqsb_: