Lineage for d4boff_ (4bof F:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1925324Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 1925325Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 1925452Family d.126.1.0: automated matches [191334] (1 protein)
    not a true family
  6. 1925453Protein automated matches [190175] (6 species)
    not a true protein
  7. 1925522Species Streptococcus pyogenes [TaxId:1314] [224940] (1 PDB entry)
  8. 1925528Domain d4boff_: 4bof F: [219530]
    automated match to d1rxxb_
    complexed with pg4, pge, so4

Details for d4boff_

PDB Entry: 4bof (more details), 2.48 Å

PDB Description: crystal structure of arginine deiminase from group a streptococcus
PDB Compounds: (F:) Arginine deiminase

SCOPe Domain Sequences for d4boff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4boff_ d.126.1.0 (F:) automated matches {Streptococcus pyogenes [TaxId: 1314]}
aqtpihvyseigklkkvllhrpgkeienlmpdylerllfddipfledaqkehdafaqalr
degievlyletlaaeslvtpeireafideylseanirgratkkairellmaiednqelie
ktmagvqkselpeipasekgltdlvesnypfaidpmpnlyftrdpfatigtgvslnhmfs
etrnretlygkyifthhpiygggkvpmvydrnettrieggdelvlskdvlavgisqrtda
asiekllvnifkqnlgfkkvlafefannrkfmhldtvftmvdydkftihpeiegdlrvys
vtydneelhiveekgdlaellaanlgvekvdlircggdnlvaagreqwndgsntltiapg
vvvvynrntitnaileskglklikihgselvrgrggprcmsmpferedi

SCOPe Domain Coordinates for d4boff_:

Click to download the PDB-style file with coordinates for d4boff_.
(The format of our PDB-style files is described here.)

Timeline for d4boff_: