![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily) duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis |
![]() | Superfamily d.126.1: Pentein [55909] (8 families) ![]() |
![]() | Family d.126.1.0: automated matches [191334] (1 protein) not a true family |
![]() | Protein automated matches [190175] (10 species) not a true protein |
![]() | Species Streptococcus pyogenes [TaxId:1314] [224940] (1 PDB entry) |
![]() | Domain d4bofd_: 4bof D: [219528] automated match to d1rxxb_ complexed with pg4, pge, so4 |
PDB Entry: 4bof (more details), 2.48 Å
SCOPe Domain Sequences for d4bofd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bofd_ d.126.1.0 (D:) automated matches {Streptococcus pyogenes [TaxId: 1314]} aqtpihvyseigklkkvllhrpgkeienlmpdylerllfddipfledaqkehdafaqalr degievlyletlaaeslvtpeireafideylseanirgratkkairellmaiednqelie ktmagvqkselpeipasekgltdlvesnypfaidpmpnlyftrdpfatigtgvslnhmfs etrnretlygkyifthhpiygggkvpmvydrnettrieggdelvlskdvlavgisqrtda asiekllvnifkqnlgfkkvlafefannrkfmhldtvftmvdydkftihpeiegdlrvys vtydneelhiveekgdlaellaanlgvekvdlircggdnlvaagreqwndgsntltiapg vvvvynrntitnaileskglklikihgselvrgrggprcmsmpferedi
Timeline for d4bofd_: