Lineage for d4bofb_ (4bof B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974297Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2974298Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2974447Family d.126.1.0: automated matches [191334] (1 protein)
    not a true family
  6. 2974448Protein automated matches [190175] (10 species)
    not a true protein
  7. 2974553Species Streptococcus pyogenes [TaxId:1314] [224940] (1 PDB entry)
  8. 2974555Domain d4bofb_: 4bof B: [219526]
    automated match to d1rxxb_
    complexed with pg4, pge, so4

Details for d4bofb_

PDB Entry: 4bof (more details), 2.48 Å

PDB Description: crystal structure of arginine deiminase from group a streptococcus
PDB Compounds: (B:) Arginine deiminase

SCOPe Domain Sequences for d4bofb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bofb_ d.126.1.0 (B:) automated matches {Streptococcus pyogenes [TaxId: 1314]}
mtaqtpihvyseigklkkvllhrpgkeienlmpdylerllfddipfledaqkehdafaqa
lrdegievlyletlaaeslvtpeireafideylseanirgratkkairellmaiednqel
iektmagvqkselpeipasekgltdlvesnypfaidpmpnlyftrdpfatigtgvslnhm
fsetrnretlygkyifthhpiygggkvpmvydrnettrieggdelvlskdvlavgisqrt
daasiekllvnifkqnlgfkkvlafefannrkfmhldtvftmvdydkftihpeiegdlrv
ysvtydneelhiveekgdlaellaanlgvekvdlircggdnlvaagreqwndgsntltia
pgvvvvynrntitnaileskglklikihgselvrgrggprcmsmpferedi

SCOPe Domain Coordinates for d4bofb_:

Click to download the PDB-style file with coordinates for d4bofb_.
(The format of our PDB-style files is described here.)

Timeline for d4bofb_: