Lineage for d4bnqb_ (4bnq B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2882121Superfamily c.51.4: ITPase-like [52972] (4 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 2882183Family c.51.4.0: automated matches [191335] (1 protein)
    not a true family
  6. 2882184Protein automated matches [190179] (9 species)
    not a true protein
  7. 2882230Species Staphylococcus aureus [TaxId:46170] [226675] (1 PDB entry)
  8. 2882232Domain d4bnqb_: 4bnq B: [219524]
    automated match to d2j4ee_
    complexed with gol, po4

Details for d4bnqb_

PDB Entry: 4bnq (more details), 2.28 Å

PDB Description: The structure of the Staphylococcus aureus Ham1 protein
PDB Compounds: (B:) Non-canonical purine NTP pyrophosphatase

SCOPe Domain Sequences for d4bnqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bnqb_ c.51.4.0 (B:) automated matches {Staphylococcus aureus [TaxId: 46170]}
keiviasnnqgkindfkvifpdyhvigiselipdfdveetgstfeenailkseaaakaln
ktviaddsglevfalngepgiysaryagenksdeaniekllnklgnttdrraqfvcvism
sgpdmetkvfkgtvsgeiadgkygengfgydpifyvpkldktmaqlskeqkgqishrrna
inllqaflegekn

SCOPe Domain Coordinates for d4bnqb_:

Click to download the PDB-style file with coordinates for d4bnqb_.
(The format of our PDB-style files is described here.)

Timeline for d4bnqb_: