Lineage for d4bmaa_ (4bma A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133953Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2133954Protein automated matches [190951] (26 species)
    not a true protein
  7. 2133967Species Aspergillus fumigatus [TaxId:5085] [226664] (1 PDB entry)
  8. 2133968Domain d4bmaa_: 4bma A: [219520]
    automated match to d1vm8b_
    complexed with gol

Details for d4bmaa_

PDB Entry: 4bma (more details), 2.08 Å

PDB Description: structural of Aspergillus fumigatus UDP-N-acetylglucosamine pyrophosphorylase
PDB Compounds: (A:) udp-n-acetylglucosamine pyrophosphorylase

SCOPe Domain Sequences for d4bmaa_:

Sequence, based on SEQRES records: (download)

>d4bmaa_ c.68.1.0 (A:) automated matches {Aspergillus fumigatus [TaxId: 5085]}
psaeefqqlrkkytdagqghvfafvdelqtgersqlfhqlssfdpvrineladkalnppk
addgpasleplpdiatasildsdpkdleqwyeeglklvagnkvavvlmaggqgtrlgssa
pkgcfdiglpshkslfqiqaeriaklqllaqrisgkeavipwyvmtsgptrkpteeffeq
hkyfglnksdviifeqgvlpcisnegkilmeskfkvavapdgnggiyqalltsgvredmr
krgiehihtycvdnclvkvadpvfigfaaskqvdiatkvvrkrnatesvglilqkngkpd
vveyseidketaeakdpkqpdvlkfraanivnhyysfkffesielwahklphhvarkkip
cikegtgeffkpekpngikleqfvfdvfpmtplekfacievrredefsplknargtgedd
pdtskrdimsqgqrwiekaggivitegdvvgvevsplisyggegleflkgreikapafie
k

Sequence, based on observed residues (ATOM records): (download)

>d4bmaa_ c.68.1.0 (A:) automated matches {Aspergillus fumigatus [TaxId: 5085]}
psaeefqqlrkkytdagqghvfafvdelqtgersqlfhqlssfdpvrineladkalnppp
asleplpdiatasildsdpkdleqwyeeglklvagnkvavvlmaggqgtrlgssapkgcf
diglpshkslfqiqaeriaklqllaqrisgkeavipwyvmtsgptrkpteeffeqhkyfg
lnksdviifeqgvlpcisnegkilmeskfkvavapdgnggiyqalltsgvredmrkrgie
hihtycvdnclvkvadpvfigfaaskqvdiatkvvrkrnatesvglilqkngkpdvveys
eidketaeakdpkqpdvlkfraanivnhyysfkffesielwahklphhvarkkipcikpn
gikleqfvfdvfpmtplekfacievrredefsplknargtgeddpdtskrdimsqgqrwi
ekaggivitegdvvgvevsplisyggegleflkgreikapafiek

SCOPe Domain Coordinates for d4bmaa_:

Click to download the PDB-style file with coordinates for d4bmaa_.
(The format of our PDB-style files is described here.)

Timeline for d4bmaa_: