Lineage for d4blwa_ (4blw A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468838Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2468839Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2470351Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2470352Protein automated matches [190689] (66 species)
    not a true protein
  7. 2470427Species Escherichia coli K-12 [TaxId:83333] [196426] (7 PDB entries)
  8. 2470430Domain d4blwa_: 4blw A: [219518]
    automated match to d2oo3a1
    protein/RNA complex; complexed with amp, edo, gol, na, sah, so4

Details for d4blwa_

PDB Entry: 4blw (more details), 1.95 Å

PDB Description: crystal structure of escherichia coli 23s rrna (a2030-n6)- methyltransferase rlmj in complex with s-adenosylhomocysteine (adohcy) and adenosine monophosphate (amp)
PDB Compounds: (A:) Ribosomal RNA large subunit methyltransferase J

SCOPe Domain Sequences for d4blwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4blwa_ c.66.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mlsyrhsfhagnhadvlkhtvqsliieslkekdkpflyldthagagryqlgsehaertge
ylegiariwqqddlpaeleayinvvkhfnrsgqlryypgspliarlllreqdslqltelh
psdypllrsefqkdsrarvekadgfqqlkaklppvsrrglilidppyemktdyqavvsgi
aegykrfatgiyalwypvvlrqqikrmihdleatgirkilqielavlpdsdrrgmtasgm
ivinppwkleqqmnnvlpwlhsklvpagtghatvswivpe

SCOPe Domain Coordinates for d4blwa_:

Click to download the PDB-style file with coordinates for d4blwa_.
(The format of our PDB-style files is described here.)

Timeline for d4blwa_: