SCOPe 2.05: Domain d4blua_: 4blu A:

Lineage for d4blua_ (4blu A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (49 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [196426] (5 PDB entries)

8. Domain d4blua_: 4blu A: [219514]
   automated match to d2oo3a1
   complexed with edo, gol, peg, so4, trs

Details for d4blua_

PDB Entry: 4blu, 1.85 Å

PDB Description: Crystal structure of Escherichia coli 23S rRNA (A2030-N6)- methyltransferase RlmJ

PDB Compounds: (A:) Ribosomal RNA large subunit methyltransferase J

SCOPe Domain Sequences for d4blua_:

Sequence; same for both SEQRES and ATOM records:

>d4blua_ c.66.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lsyrhsfhagnhadvlkhtvqsliieslkekdkpflyldthagagryqlgsehaertgey
legiariwqqddlpaeleayinvvkhfnrsgqlryypgspliarlllreqdslqltelhp
sdypllrsefqkdsrarvekadgfqqlkaklppvsrrglilidppyemktdyqavvsgia
egykrfatgiyalwypvvlrqqikrmihdleatgirkilqielavlpdsdrrgmtasgmi
vinppwkleqqmnnvlpwlhsklvpagtghatvswivpe

Timeline for d4blua_:

• d4blua_ first appeared in SCOPe 2.03
  
• d4blua_ appears in SCOPe 2.04
  
• d4blua_ appears in SCOPe 2.06
  
• d4blua_ appears in the current release, SCOPe 2.08