![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (1 family) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (18 proteins) |
![]() | Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49268] (7 PDB entries) |
![]() | Domain d2hft_1: 2hft 1-106 [21951] |
PDB Entry: 2hft (more details), 1.69 Å
SCOP Domain Sequences for d2hft_1:
Sequence, based on SEQRES records: (download)
>d2hft_1 b.1.2.1 (1-106) Extracellular region of human tissue factor {Human (Homo sapiens)} sgttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdlt deivkdvkqtylarvfsypagnvestgsageplyenspeftpylet
>d2hft_1 b.1.2.1 (1-106) Extracellular region of human tissue factor {Human (Homo sapiens)} sgttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdlt deivkdvkqtylarvfsypagnvesteplyenspeftpylet
Timeline for d2hft_1: