SCOPe 2.04: Domain d4bkpa_: 4bkp A:

Lineage for d4bkpa_ (4bkp A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (181 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (37 PDB entries)

8. Domain d4bkpa_: 4bkp A: [219501]
   automated match to d4b8wa_
   complexed with edo, flc, nap

Details for d4bkpa_

PDB Entry: 4bkp, 2.7 Å

PDB Description: crystal structure of human gdp-l-fucose synthase with bound nadp

PDB Compounds: (A:) GDP-l-fucose synthase

SCOPe Domain Sequences for d4bkpa_:

Sequence; same for both SEQRES and ATOM records:

>d4bkpa_ c.2.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlgtenlyfqsmrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtra
lfekvqpthvihlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstc
ifpdkttypidetmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgp
hdnfniedghvlpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreyne
vepiilsvgeedevsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdf
rftpfkqavketcawftdnyeqar

Timeline for d4bkpa_:

• d4bkpa_ first appeared in SCOPe 2.03
  
• d4bkpa_ appears in SCOPe 2.05
  
• d4bkpa_ appears in the current release, SCOPe 2.08, called d4bkpa1