Lineage for d4bkpa_ (4bkp A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1350556Species Human (Homo sapiens) [TaxId:9606] [186944] (28 PDB entries)
  8. 1350630Domain d4bkpa_: 4bkp A: [219501]
    automated match to d4b8wa_
    complexed with edo, flc, nap

Details for d4bkpa_

PDB Entry: 4bkp (more details), 2.7 Å

PDB Description: crystal structure of human gdp-l-fucose synthase with bound nadp
PDB Compounds: (A:) GDP-l-fucose synthase

SCOPe Domain Sequences for d4bkpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bkpa_ c.2.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlgtenlyfqsmrilvtggsglvgkaiqkvvadgaglpgedwvfvsskdadltdtaqtra
lfekvqpthvihlaamvgglfrnikynldfwrknvhmndnvlhsafevgarkvvsclstc
ifpdkttypidetmihngpphnsnfgysyakrmidvqnrayfqqygctftaviptnvfgp
hdnfniedghvlpglihkvhlakssgsaltvwgtgnprrqfiysldlaqlfiwvlreyne
vepiilsvgeedevsikeaaeavveamdfhgevtfdttksdgqfkktasnsklrtylpdf
rftpfkqavketcawftdnyeqar

SCOPe Domain Coordinates for d4bkpa_:

Click to download the PDB-style file with coordinates for d4bkpa_.
(The format of our PDB-style files is described here.)

Timeline for d4bkpa_: