| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.13: Cellulosomal scaffoldin protein CipC, module x2.1 [81293] (1 protein) automatically mapped to Pfam PF03442 |
| Protein Cellulosomal scaffoldin protein CipC, module x2.1 [49263] (1 species) |
| Species Clostridium cellulolyticum [TaxId:1521] [49264] (1 PDB entry) |
| Domain d1ehxa_: 1ehx A: [21950] |
PDB Entry: 1ehx (more details)
SCOPe Domain Sequences for d1ehxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ehxa_ b.1.18.13 (A:) Cellulosomal scaffoldin protein CipC, module x2.1 {Clostridium cellulolyticum [TaxId: 1521]}
mqdptinptsisakagsfadtkitltpngntfngiselqssqytkgtnevtllasylntl
penttktltfdfgvgtknpkltitvlpkdipgle
Timeline for d1ehxa_: