Lineage for d4bgfg_ (4bgf G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927182Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 proteins)
    fold similar to that of the factor XIII catalytic domain
    automatically mapped to Pfam PF00797
  6. 2927207Protein automated matches [190090] (5 species)
    not a true protein
  7. 2927223Species Mycobacterium tuberculosis [TaxId:83332] [224915] (1 PDB entry)
  8. 2927230Domain d4bgfg_: 4bgf G: [219477]
    automated match to d1gx3a_

Details for d4bgfg_

PDB Entry: 4bgf (more details), 2.1 Å

PDB Description: the 3d-structure of arylamine-n-acetyltransferase from m. tuberculosis
PDB Compounds: (G:) Arylamine N-acetyltransferase Nat

SCOPe Domain Sequences for d4bgfg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bgfg_ d.3.1.5 (G:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ldltayfdrinyrgatdptldvlqdlvtvhsrtipfenldpllgvpvddlspqaladklv
lrrrggycfehnglmgyvlaelgyrvrrfaarvvwklapdaplppqthtllgvtfpgsgg
cylvdvgfggqtptsplrletgavqptthepyrledrvdgfvlqamvrdtwqtlyefttq
trpqidlkvaswyasthpaskfvtgltaavitddarwnlsgrdlavhraggtekirlada
aavvdtlserfginvadigergaletride

SCOPe Domain Coordinates for d4bgfg_:

Click to download the PDB-style file with coordinates for d4bgfg_.
(The format of our PDB-style files is described here.)

Timeline for d4bgfg_: