| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
| Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 proteins) fold similar to that of the factor XIII catalytic domain automatically mapped to Pfam PF00797 |
| Protein automated matches [190090] (5 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:83332] [224915] (1 PDB entry) |
| Domain d4bgfc_: 4bgf C: [219473] automated match to d1gx3a_ |
PDB Entry: 4bgf (more details), 2.1 Å
SCOPe Domain Sequences for d4bgfc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bgfc_ d.3.1.5 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dltayfdrinyrgatdptldvlqdlvtvhsrtipfenldpllgvpvddlspqaladklvl
rrrggycfehnglmgyvlaelgyrvrrfaarvvwklapdaplppqthtllgvtfpgsggc
ylvdvgfggqtptsplrletgavqptthepyrledrvdgfvlqamvrdtwqtlyefttqt
rpqidlkvaswyasthpaskfvtgltaavitddarwnlsgrdlavhraggtekirladaa
avvdtlserfginvadigergaletride
Timeline for d4bgfc_: