SCOP 1.73: Domain d1soxa1: 1sox A:344-466

Lineage for d1soxa1 (1sox A:344-466)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.6: Molybdenum-containing oxidoreductases-like dimerisation domain [81286] (1 protein)

6. Protein Sulfite oxidase, C-terminal domain [49259] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [49260] (5 PDB entries)

8. Domain d1soxa1: 1sox A:344-466 [21947]
   Other proteins in same PDB: d1soxa2, d1soxa3, d1soxb2, d1soxb3

Details for d1soxa1

PDB Entry: 1sox, 1.9 Å

PDB Description: sulfite oxidase from chicken liver

PDB Compounds: (A:) sulfite oxidase

SCOP Domain Sequences for d1soxa1:

Sequence; same for both SEQRES and ATOM records:

>d1soxa1 b.1.18.6 (A:344-466) Sulfite oxidase, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
elpvqsavtqprpgaavppgeltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkap
pgrawawalweltvpveagteleivckavdssynvqpdsvapiwnlrgvlstawhrvrvs
vqd

Timeline for d1soxa1:

• d1soxa1 first appeared (with stable ids) in SCOP 1.55
  
• d1soxa1 appears in SCOP 1.71
  
• d1soxa1 appears in SCOP 1.75
  
• d1soxa1 appears in the current release, SCOPe 2.08