Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (18 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.6: Molybdenum-containing oxidoreductases-like dimerisation domain [81286] (1 protein) |
Protein Sulfite oxidase, C-terminal domain [49259] (2 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [49260] (1 PDB entry) |
Domain d1soxa1: 1sox A:344-466 [21947] Other proteins in same PDB: d1soxa2, d1soxa3, d1soxb2, d1soxb3 |
PDB Entry: 1sox (more details), 1.9 Å
SCOP Domain Sequences for d1soxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1soxa1 b.1.18.6 (A:344-466) Sulfite oxidase, C-terminal domain {Chicken (Gallus gallus)} elpvqsavtqprpgaavppgeltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkap pgrawawalweltvpveagteleivckavdssynvqpdsvapiwnlrgvlstawhrvrvs vqd
Timeline for d1soxa1: