Lineage for d1soxa1 (1sox A:344-466)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160629Family b.1.1.5: E set domains [49208] (27 proteins)
  6. 160870Protein Sulfite oxidase, C-terminal domain [49259] (1 species)
  7. 160871Species Chicken (Gallus gallus) [TaxId:9031] [49260] (1 PDB entry)
  8. 160872Domain d1soxa1: 1sox A:344-466 [21947]
    Other proteins in same PDB: d1soxa2, d1soxa3, d1soxb2, d1soxb3

Details for d1soxa1

PDB Entry: 1sox (more details), 1.9 Å

PDB Description: sulfite oxidase from chicken liver

SCOP Domain Sequences for d1soxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1soxa1 b.1.1.5 (A:344-466) Sulfite oxidase, C-terminal domain {Chicken (Gallus gallus)}
elpvqsavtqprpgaavppgeltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkap
pgrawawalweltvpveagteleivckavdssynvqpdsvapiwnlrgvlstawhrvrvs
vqd

SCOP Domain Coordinates for d1soxa1:

Click to download the PDB-style file with coordinates for d1soxa1.
(The format of our PDB-style files is described here.)

Timeline for d1soxa1: