Lineage for d4bfsa_ (4bfs A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114530Species Mycobacterium tuberculosis [TaxId:83332] [187746] (21 PDB entries)
  8. 2114553Domain d4bfsa_: 4bfs A: [219466]
    automated match to d4bfza_
    complexed with zvs

Details for d4bfsa_

PDB Entry: 4bfs (more details), 2.9 Å

PDB Description: Crystal structure of Mycobacterium tuberculosis PanK in complex with a triazole inhibitory compound (1a)
PDB Compounds: (A:) pantothenate kinase

SCOPe Domain Sequences for d4bfsa_:

Sequence, based on SEQRES records: (download)

>d4bfsa_ c.37.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
epspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqva
arqrlfaataeflgepqqnpdrpvpfiigvagsvavgksttarvlqallarwdhhprvdl
vttdgflypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydii
pgaeqvvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrtt
afadpeshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsin
rlrlrkl

Sequence, based on observed residues (ATOM records): (download)

>d4bfsa_ c.37.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
epspyvefdrrqwralrmstplalteeelvglrglgeqidlleveevylplarlihlqva
arqrlfaataeflgeprpvpfiigvagsvavgksttarvlqallarwdhhprvdlvttdg
flypnaelqrrnlmhrkgfpesynrralmrfvtsvksgsdyacapvyshlhydiipgaeq
vvrhpdilileglnvlqtgptlmvsdlfdfslyvdariedieqwyvsrflamrttafadp
eshfhhyaafsdsqavvaareiwrtinrpnlvenilptrpratlvlrkdadhsinrlrlr
kl

SCOPe Domain Coordinates for d4bfsa_:

Click to download the PDB-style file with coordinates for d4bfsa_.
(The format of our PDB-style files is described here.)

Timeline for d4bfsa_: