Lineage for d4bf7a1 (4bf7 A:1-333)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.3: beta-glycanases [51487] (27 proteins)
consist of a number of sequence families
Protein automated matches [190057] (28 species)
not a true protein
Species Emericella nidulans [TaxId:162425] [226738] (1 PDB entry) 
Domain d4bf7a1: 4bf7 A:1-333 [219463]
Other proteins in same PDB: d4bf7a2
automated match to d1foba_
complexed with act, gol, imd, nag, zn
Details for d4bf7a1
PDB Entry: 4bf7 (more details), 2 Å
PDB Description: emericilla nidulans endo-beta-1,4-galactanase
PDB Compounds: (A:) arabinogalactan endo-1,4-beta-galactosidase aSCOPe Domain Sequences for d4bf7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bf7a1 c.1.8.3 (A:1-333) automated matches {Emericella nidulans [TaxId: 162425]}
altyrgadissllieedsgvayknlngetqafelilanngvnsirqriwvnpsdgsynle
ynlelakrvqdagmsvyldlhlsdtwadpgdqatpsgwsttdidtlawqvynytldvcnt
faennvaveivsigneirngllhplgstdhydniarllhsgawgvkdsslsttpkilfhl
dngwdwdaqkyfydtvlatgtllstdfdligvsyypfynadatlsslktsltnlksnygk
nvlvvetdwpvqcsspeyafpsdlssipfsadgqetflgrladtledvggvgiyywepgw
vdnaglgsscednlmvdwrdrtvresisvfgdl
SCOPe Domain Coordinates for d4bf7a1:
Click to download the PDB-style file with coordinates for d4bf7a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4bf7a1:
- d4bf7a1 first appeared in SCOPe 2.03, called d4bf7a_
- d4bf7a1 appears in SCOPe 2.07
View in 3D
