Lineage for d4bf7a1 (4bf7 A:1-333)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831217Protein automated matches [190057] (28 species)
    not a true protein
  7. 2831296Species Emericella nidulans [TaxId:162425] [226738] (1 PDB entry)
  8. 2831297Domain d4bf7a1: 4bf7 A:1-333 [219463]
    Other proteins in same PDB: d4bf7a2
    automated match to d1foba_
    complexed with act, gol, imd, nag, zn

Details for d4bf7a1

PDB Entry: 4bf7 (more details), 2 Å

PDB Description: emericilla nidulans endo-beta-1,4-galactanase
PDB Compounds: (A:) arabinogalactan endo-1,4-beta-galactosidase a

SCOPe Domain Sequences for d4bf7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bf7a1 c.1.8.3 (A:1-333) automated matches {Emericella nidulans [TaxId: 162425]}
altyrgadissllieedsgvayknlngetqafelilanngvnsirqriwvnpsdgsynle
ynlelakrvqdagmsvyldlhlsdtwadpgdqatpsgwsttdidtlawqvynytldvcnt
faennvaveivsigneirngllhplgstdhydniarllhsgawgvkdsslsttpkilfhl
dngwdwdaqkyfydtvlatgtllstdfdligvsyypfynadatlsslktsltnlksnygk
nvlvvetdwpvqcsspeyafpsdlssipfsadgqetflgrladtledvggvgiyywepgw
vdnaglgsscednlmvdwrdrtvresisvfgdl

SCOPe Domain Coordinates for d4bf7a1:

Click to download the PDB-style file with coordinates for d4bf7a1.
(The format of our PDB-style files is described here.)

Timeline for d4bf7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bf7a2