![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.17: PEBP-like [49776] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
![]() | Superfamily b.17.1: PEBP-like [49777] (3 families) ![]() |
![]() | Family b.17.1.0: automated matches [191496] (1 protein) not a true family |
![]() | Protein automated matches [190806] (3 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [226748] (1 PDB entry) |
![]() | Domain d4begb_: 4beg B: [219462] Other proteins in same PDB: d4bega2 automated match to d1fuxb_ complexed with gol, so4 |
PDB Entry: 4beg (more details), 1.42 Å
SCOPe Domain Sequences for d4begb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4begb_ b.17.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} ttspdpyaalpklpsfsltstsitdgqplatpqvsgimgaggadaspqlrwsgfpsetrs favtvydpdaptlsgfwhwavanlpanvtelpegvgdgrelpggaltlvndagmrryvga apppghgvhryyvavhavkvekldlpedaspaylgfnlfqhaiaravifgtyeqr
Timeline for d4begb_: