Lineage for d4begb_ (4beg B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774037Fold b.17: PEBP-like [49776] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2774038Superfamily b.17.1: PEBP-like [49777] (3 families) (S)
  5. 2774083Family b.17.1.0: automated matches [191496] (1 protein)
    not a true family
  6. 2774084Protein automated matches [190806] (3 species)
    not a true protein
  7. 2774088Species Mycobacterium tuberculosis [TaxId:83332] [226748] (1 PDB entry)
  8. 2774090Domain d4begb_: 4beg B: [219462]
    Other proteins in same PDB: d4bega2
    automated match to d1fuxb_
    complexed with gol, so4

Details for d4begb_

PDB Entry: 4beg (more details), 1.42 Å

PDB Description: structure of rv2140c, a phosphatidyl-ethanolamine binding protein from mycobacterium tuberculosis in complex with sulphate
PDB Compounds: (B:) phosphatidylethanolamine binding protein

SCOPe Domain Sequences for d4begb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4begb_ b.17.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ttspdpyaalpklpsfsltstsitdgqplatpqvsgimgaggadaspqlrwsgfpsetrs
favtvydpdaptlsgfwhwavanlpanvtelpegvgdgrelpggaltlvndagmrryvga
apppghgvhryyvavhavkvekldlpedaspaylgfnlfqhaiaravifgtyeqr

SCOPe Domain Coordinates for d4begb_:

Click to download the PDB-style file with coordinates for d4begb_.
(The format of our PDB-style files is described here.)

Timeline for d4begb_: