SCOPe 2.08: Domain d4bega1: 4beg A:1-176

Lineage for d4bega1 (4beg A:1-176)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.17: PEBP-like [49776] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.17.1: PEBP-like [49777] (3 families)

5. Family b.17.1.0: automated matches [191496] (1 protein)
   not a true family

6. Protein automated matches [190806] (3 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [226748] (1 PDB entry)

8. Domain d4bega1: 4beg A:1-176 [219461]
   Other proteins in same PDB: d4bega2
   automated match to d1fuxb_
   complexed with gol, so4

Details for d4bega1

PDB Entry: 4beg, 1.42 Å

PDB Description: structure of rv2140c, a phosphatidyl-ethanolamine binding protein from mycobacterium tuberculosis in complex with sulphate

PDB Compounds: (A:) phosphatidylethanolamine binding protein

SCOPe Domain Sequences for d4bega1:

Sequence; same for both SEQRES and ATOM records:

>d4bega1 b.17.1.0 (A:1-176) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mttspdpyaalpklpsfsltstsitdgqplatpqvsgimgaggadaspqlrwsgfpsetr
sfavtvydpdaptlsgfwhwavanlpanvtelpegvgdgrelpggaltlvndagmrryvg
aapppghgvhryyvavhavkvekldlpedaspaylgfnlfqhaiaravifgtyeqr

Timeline for d4bega1:

• d4bega1 first appeared in SCOPe 2.03, called d4bega_
  
• d4bega1 appears in SCOPe 2.07