SCOPe 2.06: Domain d4bdrb_: 4bdr B:

Lineage for d4bdrb_ (4bdr B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (101 PDB entries)

8. Domain d4bdrb_: 4bdr B: [219460]
   automated match to d2znta_
   complexed with cl, kai, na

Details for d4bdrb_

PDB Entry: 4bdr, 1.65 Å

PDB Description: crystal structure of the gluk2 r775a lbd dimer in complex with kainate

PDB Compounds: (B:) Glutamate receptor, ionotropic kainate 2

SCOPe Domain Sequences for d4bdrb_:

Sequence, based on SEQRES records:

>d4bdrb_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
slivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgkygaq
ddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkgtpidsa
ddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqrvlts
dyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyadkitiailqlqeegkl
hmmkekwwrgngc

Sequence, based on observed residues (ATOM records):

>d4bdrb_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
slivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgkygaq
ddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkgtpidsa
ddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqrvlts
dyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyadkitiailqlqeegkl
hmmkekwwc

Timeline for d4bdrb_:

• d4bdrb_ first appeared in SCOPe 2.03
  
• d4bdrb_ appears in SCOPe 2.05
  
• d4bdrb_ appears in SCOPe 2.07
  
• d4bdrb_ appears in the current release, SCOPe 2.08