Lineage for d1a9v__ (1a9v -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.5: E set domains [49208] (24 proteins) 
Protein Major mite allergen [49256] (2 species) Species House-dust mite (Dermatophagoides pteronyssinus), Der p 2 [TaxId:6956] [49258] (1 PDB entry) 
Domain d1a9v__: 1a9v - [21946]
Details for d1a9v__
PDB Entry: 1a9v (more details)
PDB Description: tertiary structure of the major house dust mite allergen der p 2, nmr, 10 structures
SCOP Domain Sequences for d1a9v__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a9v__ b.1.1.5 (-) Major mite allergen {House-dust mite (Dermatophagoides pteronyssinus), Der p 2}
sqvdvkdcanheikkvlvpgchgsepciihrgkpfqleavfeanqntktakieikasidg
levdvpgidpnachymkcplvkgqqydikytwnvpkiapksenvvvtvkvmgddgvlaca
iathakird
SCOP Domain Coordinates for d1a9v__:
Click to download the PDB-style file with coordinates for d1a9v__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a9v__:
- d1a9v__ first appeared (with stable ids) in SCOP 1.55
- d1a9v__ appears in SCOP 1.59
- d1a9v__ appears in the current release, SCOPe 2.08, called d1a9va_
View in 3D