Lineage for d1a9va_ (1a9v A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765571Family b.1.18.7: ML domain [81287] (3 proteins)
    implicated in lipid recognition, particularly in the recognition of pathogen related products
    automatically mapped to Pfam PF02221
  6. 2765578Protein Major mite allergen [49256] (2 species)
    contains additional N-terminal strand
  7. 2765589Species House-dust mite (Dermatophagoides pteronyssinus), Der p 2 [TaxId:6956] [49258] (2 PDB entries)
  8. 2765592Domain d1a9va_: 1a9v A: [21946]

Details for d1a9va_

PDB Entry: 1a9v (more details)

PDB Description: tertiary structure of the major house dust mite allergen der p 2, nmr, 10 structures
PDB Compounds: (A:) mite allergen der p 2

SCOPe Domain Sequences for d1a9va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9va_ b.1.18.7 (A:) Major mite allergen {House-dust mite (Dermatophagoides pteronyssinus), Der p 2 [TaxId: 6956]}
sqvdvkdcanheikkvlvpgchgsepciihrgkpfqleavfeanqntktakieikasidg
levdvpgidpnachymkcplvkgqqydikytwnvpkiapksenvvvtvkvmgddgvlaca
iathakird

SCOPe Domain Coordinates for d1a9va_:

Click to download the PDB-style file with coordinates for d1a9va_.
(The format of our PDB-style files is described here.)

Timeline for d1a9va_: