SCOPe 2.07: Domain d4bdqa_: 4bdq A:

Lineage for d4bdqa_ (4bdq A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (113 PDB entries)

8. Domain d4bdqa_: 4bdq A: [219457]
   automated match to d2znta_
   complexed with glu, na

Details for d4bdqa_

PDB Entry: 4bdq, 1.9 Å

PDB Description: crystal structure of the gluk2 r775a lbd dimer in complex with glutamate

PDB Compounds: (A:) Glutamate receptor, ionotropic kainate 2

SCOPe Domain Sequences for d4bdqa_:

Sequence, based on SEQRES records:

>d4bdqa_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
slivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgkygaq
ddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkgtpidsa
ddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqrvlts
dyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyadkitiailqlqeegkl
hmmkekwwrgngc

Sequence, based on observed residues (ATOM records):

>d4bdqa_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
slivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgkygaq
ddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisilyrkgtpidsa
ddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqrvlts
dyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyadkitiailqlqeegkl
hmmkekwwrc

Timeline for d4bdqa_:

• d4bdqa_ first appeared in SCOPe 2.03
  
• d4bdqa_ appears in SCOPe 2.06
  
• d4bdqa_ appears in the current release, SCOPe 2.08