Lineage for d4bdnc_ (4bdn C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915760Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (113 PDB entries)
  8. 2915938Domain d4bdnc_: 4bdn C: [219451]
    automated match to d2znta_
    complexed with glu, na

Details for d4bdnc_

PDB Entry: 4bdn (more details), 2.5 Å

PDB Description: crystal structure of the gluk2 k531a-t779g lbd dimer in complex with glutamate
PDB Compounds: (C:) Glutamate receptor, ionotropic kainate 2

SCOPe Domain Sequences for d4bdnc_:

Sequence, based on SEQRES records: (download)

>d4bdnc_ c.94.1.0 (C:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgkyga
qddvngqwngmvrelidhkadlavaplaityvrekvidfsapfmtlgisilyrkgtpids
addlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqrvlt
sdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkigiailqlqeegk
lhmmkekww

Sequence, based on observed residues (ATOM records): (download)

>d4bdnc_ c.94.1.0 (C:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgkyga
qngqwngmvrelidhkadlavaplaityvrekvidfsapfmtlgisilyrkgtpidsadd
lakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqrvltsdy
aflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkigiailqlqeegklhm
mkekww

SCOPe Domain Coordinates for d4bdnc_:

Click to download the PDB-style file with coordinates for d4bdnc_.
(The format of our PDB-style files is described here.)

Timeline for d4bdnc_: