Lineage for d4bdnb_ (4bdn B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (138 species)
    not a true protein
  7. 2145930Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (101 PDB entries)
  8. 2146079Domain d4bdnb_: 4bdn B: [219450]
    automated match to d2znta_
    complexed with glu, na

Details for d4bdnb_

PDB Entry: 4bdn (more details), 2.5 Å

PDB Description: crystal structure of the gluk2 k531a-t779g lbd dimer in complex with glutamate
PDB Compounds: (B:) Glutamate receptor, ionotropic kainate 2

SCOPe Domain Sequences for d4bdnb_:

Sequence, based on SEQRES records: (download)

>d4bdnb_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgkyga
qddvngqwngmvrelidhkadlavaplaityvrekvidfsapfmtlgisilyrkgtpids
addlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqrvlt
sdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkigiailqlqeegk
lhmmkekwwrgngc

Sequence, based on observed residues (ATOM records): (download)

>d4bdnb_ c.94.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirlvedgkyga
qddvngqwngmvrelidhkadlavaplaityvrekvidfsapfmtlgisilyrkgtpids
addlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneegiqrvlt
sdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkigiailqlqeegk
lhmmkekwwrggc

SCOPe Domain Coordinates for d4bdnb_:

Click to download the PDB-style file with coordinates for d4bdnb_.
(The format of our PDB-style files is described here.)

Timeline for d4bdnb_: