Lineage for d1ahka_ (1ahk A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2039052Family b.1.18.7: ML domain [81287] (3 proteins)
    implicated in lipid recognition, particularly in the recognition of pathogen related products
    automatically mapped to Pfam PF02221
  6. 2039059Protein Major mite allergen [49256] (2 species)
    contains additional N-terminal strand
  7. 2039060Species House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId:6954] [49257] (5 PDB entries)
    Uniprot Q00855 18-146
  8. 2039068Domain d1ahka_: 1ahk A: [21945]

Details for d1ahka_

PDB Entry: 1ahk (more details)

PDB Description: der f 2, the major mite allergen from dermatophagoides farinae, nmr, minimized average structure
PDB Compounds: (A:) der f 2

SCOPe Domain Sequences for d1ahka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahka_ b.1.18.7 (A:) Major mite allergen {House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId: 6954]}
dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca
iathgkird

SCOPe Domain Coordinates for d1ahka_:

Click to download the PDB-style file with coordinates for d1ahka_.
(The format of our PDB-style files is described here.)

Timeline for d1ahka_: