Lineage for d1ahk__ (1ahk -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54510Family b.1.1.5: E set domains [49208] (24 proteins)
  6. 54640Protein Major mite allergen [49256] (2 species)
  7. 54641Species House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId:6954] [49257] (2 PDB entries)
  8. 54643Domain d1ahk__: 1ahk - [21945]

Details for d1ahk__

PDB Entry: 1ahk (more details)

PDB Description: der f 2, the major mite allergen from dermatophagoides farinae, nmr, minimized average structure

SCOP Domain Sequences for d1ahk__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahk__ b.1.1.5 (-) Major mite allergen {House-dust mite (Dermatophagoides farinae), Der f 2}
dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca
iathgkird

SCOP Domain Coordinates for d1ahk__:

Click to download the PDB-style file with coordinates for d1ahk__.
(The format of our PDB-style files is described here.)

Timeline for d1ahk__: