Lineage for d4bcua_ (4bcu A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409884Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2411461Superfamily b.121.7: Satellite viruses [88650] (1 family) (S)
  5. 2411462Family b.121.7.1: Satellite viruses [88651] (3 proteins)
  6. 2411470Protein STNV coat protein [49621] (1 species)
  7. 2411471Species Satellite tobacco necrosis virus [TaxId:12881] [49622] (8 PDB entries)
  8. 2411542Domain d4bcua_: 4bcu A: [219444]
    automated match to d2buka_
    protein/RNA complex; complexed with ca

Details for d4bcua_

PDB Entry: 4bcu (more details), 2.29 Å

PDB Description: Satellite Tobacco Necrosis Virus (STNV) virus like particle in complex with the B3 aptamer
PDB Compounds: (A:) coat protein

SCOPe Domain Sequences for d4bcua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bcua_ b.121.7.1 (A:) STNV coat protein {Satellite tobacco necrosis virus [TaxId: 12881]}
rksatmravkrminthlehkrfalinsgntnatagtvqnlsngiiqgddinqrsgdqvri
vshklhvrgtaitvsqtfrfiwfrdnmnrgttptvlevlntanfmsqynpitlqqkrfti
lkdvtlncsltgesikdriinlpgqlvnyngatavaasngpgaifmlqigdslvglwdss
yeavytda

SCOPe Domain Coordinates for d4bcua_:

Click to download the PDB-style file with coordinates for d4bcua_.
(The format of our PDB-style files is described here.)

Timeline for d4bcua_: