![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (9 proteins) |
![]() | Protein automated matches [227027] (3 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [226306] (7 PDB entries) |
![]() | Domain d4bcqd1: 4bcq D:176-308 [219442] Other proteins in same PDB: d4bcqa1, d4bcqa2, d4bcqb3, d4bcqc1, d4bcqc2 automated match to d2cchb1 complexed with tjf |
PDB Entry: 4bcq (more details), 2.4 Å
SCOPe Domain Sequences for d4bcqd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bcqd1 a.74.1.1 (D:176-308) automated matches {Cow (Bos taurus) [TaxId: 9913]} pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme hlvlkvltfdlaa
Timeline for d4bcqd1: