SCOP 1.75: Domain d1ahma_: 1ahm A:

Lineage for d1ahma_ (1ahm A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (23 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.7: ML domain [81287] (2 proteins)
   implicated in lipid recognition, particularly in the recognition of pathogen related products

6. Protein Major mite allergen [49256] (2 species)
   contains additional N-terminal strand

7. Species House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId:6954] [49257] (5 PDB entries)
   Uniprot Q00855 18-146

8. Domain d1ahma_: 1ahm A: [21944]

Details for d1ahma_

PDB Entry: 1ahm

PDB Description: der f 2, the major mite allergen from dermatophagoides farinae, nmr, 10 structures

PDB Compounds: (A:) der f 2

SCOP Domain Sequences for d1ahma_:

Sequence; same for both SEQRES and ATOM records:

>d1ahma_ b.1.18.7 (A:) Major mite allergen {House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId: 6954]}
dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca
iathgkird

Timeline for d1ahma_:

• d1ahma_ first appeared (with stable ids) in SCOP 1.55, called d1ahm__
  
• d1ahma_ appears in SCOP 1.73
  
• d1ahma_ appears in SCOPe 2.01
  
• d1ahma_ appears in the current release, SCOPe 2.08