Lineage for d1ahm__ (1ahm -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9579Family b.1.1.5: E set domains [49208] (23 proteins)
  6. 9700Protein Major mite allergen [49256] (2 species)
  7. 9701Species House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId:6954] [49257] (2 PDB entries)
  8. 9702Domain d1ahm__: 1ahm - [21944]

Details for d1ahm__

PDB Entry: 1ahm (more details)

PDB Description: der f 2, the major mite allergen from dermatophagoides farinae, nmr, 10 structures

SCOP Domain Sequences for d1ahm__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahm__ b.1.1.5 (-) Major mite allergen {House-dust mite (Dermatophagoides farinae), Der f 2}
dqvdvkdcanneikkvmvdgchgsdpciihrgkpftlealfdanqntktakieikasldg
leidvpgidtnachfvkcplvkgqqydikytwnvpkiapksenvvvtvkligdngvlaca
iathgkird

SCOP Domain Coordinates for d1ahm__:

Click to download the PDB-style file with coordinates for d1ahm__.
(The format of our PDB-style files is described here.)

Timeline for d1ahm__: