Class a: All alpha proteins [46456] (284 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein automated matches [227027] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225840] (4 PDB entries) |
Domain d4bcnd1: 4bcn D:177-308 [219430] Other proteins in same PDB: d4bcna_, d4bcnc_ automated match to d2cchb1 complexed with so4, t9n |
PDB Entry: 4bcn (more details), 2.1 Å
SCOPe Domain Sequences for d4bcnd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bcnd1 a.74.1.1 (D:177-308) automated matches {Human (Homo sapiens) [TaxId: 9606]} dyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlav nyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmeh lvlkvltfdlaa
Timeline for d4bcnd1:
View in 3D Domains from other chains: (mouse over for more information) d4bcna_, d4bcnb1, d4bcnb2, d4bcnc_ |