SCOP 1.59: Domain d1nfic1: 1nfi C:190-320

Lineage for d1nfic1 (1nfi C:190-320)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.5: E set domains [49208] (25 proteins)

6. Protein p65 subunit of NF-kappa B (NFKB), C-terminal domain [49253] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49255] (1 PDB entry)

8. Domain d1nfic1: 1nfi C:190-320 [21943]
   Other proteins in same PDB: d1nfia2, d1nfib_, d1nfic2, d1nfid_, d1nfie_, d1nfif_

Details for d1nfic1

PDB Entry: 1nfi, 2.7 Å

PDB Description: i-kappa-b-alpha/nf-kappa-b complex

SCOP Domain Sequences for d1nfic1:

Sequence; same for both SEQRES and ATOM records:

>d1nfic1 b.1.1.5 (C:190-320) p65 subunit of NF-kappa B (NFKB), C-terminal domain {Human (Homo sapiens)}
ntaelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqva
ivfrtppyadpslqapvrvsmqlrrpsdrelsepmefqylpdtddrhrieekrkrtyetf
ksimkkspfsg

Timeline for d1nfic1:

• d1nfic1 first appeared (with stable ids) in SCOP 1.55
  
• d1nfic1 appears in SCOP 1.57
  
• d1nfic1 appears in SCOP 1.61
  
• d1nfic1 appears in the current release, SCOPe 2.08