Lineage for d1nfia1 (1nfi A:190-314)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937486Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 937487Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 937535Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species)
  7. 937539Species Human (Homo sapiens) [TaxId:9606] [49255] (4 PDB entries)
  8. 937544Domain d1nfia1: 1nfi A:190-314 [21942]
    Other proteins in same PDB: d1nfia2, d1nfib_, d1nfic2, d1nfid_, d1nfie_, d1nfif_

Details for d1nfia1

PDB Entry: 1nfi (more details), 2.7 Å

PDB Description: i-kappa-b-alpha/nf-kappa-b complex
PDB Compounds: (A:) nf-kappa-b p65

SCOPe Domain Sequences for d1nfia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfia1 b.1.18.1 (A:190-314) p65 subunit of NF-kappa B (NFKB), dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
ntaelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqva
ivfrtppyadpslqapvrvsmqlrrpsdrelsepmefqylpdtddrhrieekrkrtyetf
ksimk

SCOPe Domain Coordinates for d1nfia1:

Click to download the PDB-style file with coordinates for d1nfia1.
(The format of our PDB-style files is described here.)

Timeline for d1nfia1: