Lineage for d4bchb2 (4bch B:151-259)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331190Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2331191Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2331192Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2331598Protein Cyclin T1 [158595] (1 species)
  7. 2331599Species Human (Homo sapiens) [TaxId:9606] [158596] (10 PDB entries)
    Uniprot O60563 151-259! Uniprot O60563 151-263! Uniprot O60563 5-150! Uniprot O60563 8-150
  8. 2331607Domain d4bchb2: 4bch B:151-259 [219419]
    Other proteins in same PDB: d4bcha_
    automated match to d3blhb1
    complexed with gol, t7z

Details for d4bchb2

PDB Entry: 4bch (more details), 2.96 Å

PDB Description: structure of cdk9 in complex with cyclin t and a 2-amino-4-heteroaryl- pyrimidine inhibitor
PDB Compounds: (B:) Cyclin-T1

SCOPe Domain Sequences for d4bchb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bchb2 a.74.1.1 (B:151-259) Cyclin T1 {Human (Homo sapiens) [TaxId: 9606]}
dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw
eipvstdgkhwweyvdatvtlelldelthellqilektpnrlkriwnwr

SCOPe Domain Coordinates for d4bchb2:

Click to download the PDB-style file with coordinates for d4bchb2.
(The format of our PDB-style files is described here.)

Timeline for d4bchb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bchb1
View in 3D
Domains from other chains:
(mouse over for more information)
d4bcha_