SCOPe 2.03: Domain d4bchb1: 4bch B:8-150

Lineage for d4bchb1 (4bch B:8-150)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin T1 [158595] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158596] (8 PDB entries)
   Uniprot O60563 151-259! Uniprot O60563 151-263! Uniprot O60563 5-150! Uniprot O60563 8-150

8. Domain d4bchb1: 4bch B:8-150 [219418]
   Other proteins in same PDB: d4bcha_
   automated match to d3blhb2
   complexed with gol, t7z

Details for d4bchb1

PDB Entry: 4bch, 2.96 Å

PDB Description: structure of cdk9 in complex with cyclin t and a 2-amino-4-heteroaryl- pyrimidine inhibitor

PDB Compounds: (B:) Cyclin-T1

SCOPe Domain Sequences for d4bchb1:

Sequence; same for both SEQRES and ATOM records:

>d4bchb1 a.74.1.1 (B:8-150) Cyclin T1 {Human (Homo sapiens) [TaxId: 9606]}
nnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivymh
rfymiqsftrfpgnsvapaalflaakvegqpkklehvikvahtclhpqeslpdtrseayl
qqvqdlvilesiilqtlgfelti

Timeline for d4bchb1:

• d4bchb1 is new in SCOPe 2.03-stable
  
• d4bchb1 appears in SCOPe 2.04
  
• d4bchb1 appears in the current release, SCOPe 2.08