Lineage for d4bcba2 (4bcb A:431-710)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1869550Family c.69.1.4: Prolyl oligopeptidase, C-terminal domain [53496] (2 proteins)
    N-terminal domain is a 7-bladed beta-propeller
    automatically mapped to Pfam PF00326
  6. 1869551Protein Prolyl oligopeptidase, C-terminal domain [53497] (1 species)
  7. 1869552Species Pig (Sus scrofa) [TaxId:9823] [53498] (27 PDB entries)
    Uniprot P23687
  8. 1869564Domain d4bcba2: 4bcb A:431-710 [219412]
    Other proteins in same PDB: d4bcba1
    automated match to d1qfma2
    complexed with 4i4, gol, tam

Details for d4bcba2

PDB Entry: 4bcb (more details), 1.7 Å

PDB Description: prolyl oligopeptidase from porcine brain with a covalently bound p2- substituted n-acyl-prolylpyrrolidine inhibitor
PDB Compounds: (A:) prolyl endopeptidase

SCOPe Domain Sequences for d4bcba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bcba2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
dasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisitpnysvsrli
fvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylikegytspkrlti
nggsnggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawttdygcsdskqhfew
likysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyivgrsrkqnnpl
lihvdtkaghgagkptakvieevsdmfafiarclnidwip

SCOPe Domain Coordinates for d4bcba2:

Click to download the PDB-style file with coordinates for d4bcba2.
(The format of our PDB-style files is described here.)

Timeline for d4bcba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bcba1