Lineage for d1vkxa1 (1vkx A:192-291)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770170Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 1770217Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species)
  7. 1770224Species Mouse (Mus musculus) [TaxId:10090] [49254] (13 PDB entries)
  8. 1770242Domain d1vkxa1: 1vkx A:192-291 [21941]
    Other proteins in same PDB: d1vkxa2, d1vkxb1, d1vkxb2
    protein/DNA complex

Details for d1vkxa1

PDB Entry: 1vkx (more details), 2.9 Å

PDB Description: crystal structure of the nfkb p50/p65 heterodimer complexed to the immunoglobulin kb dna
PDB Compounds: (A:) protein (nf-kappa b p65 subunit)

SCOPe Domain Sequences for d1vkxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkxa1 b.1.18.1 (A:192-291) p65 subunit of NF-kappa B (NFKB), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}
aelkicrvnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaiv
frtppyadpslqapvrvsmqlrrpsdrelsepmefqylpd

SCOPe Domain Coordinates for d1vkxa1:

Click to download the PDB-style file with coordinates for d1vkxa1.
(The format of our PDB-style files is described here.)

Timeline for d1vkxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vkxa2